Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2161361..2161965 | Replicon | chromosome |
| Accession | NZ_CP121193 | ||
| Organism | Halomonas sp. CKK8 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | P8934_RS10370 | Protein ID | WP_278030963.1 |
| Coordinates | 2161361..2161543 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | P8934_RS10375 | Protein ID | WP_133633763.1 |
| Coordinates | 2161561..2161965 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8934_RS10345 (P8934_10345) | 2156978..2157496 | - | 519 | WP_278030959.1 | L,D-transpeptidase | - |
| P8934_RS10350 (P8934_10350) | 2157496..2158164 | - | 669 | WP_278030960.1 | TetR/AcrR family transcriptional regulator | - |
| P8934_RS10355 (P8934_10355) | 2158602..2159255 | + | 654 | WP_133633777.1 | transcriptional repressor LexA | - |
| P8934_RS10360 (P8934_10360) | 2159280..2160338 | + | 1059 | WP_278030961.1 | DNA polymerase IV | - |
| P8934_RS10365 (P8934_10365) | 2160422..2161093 | - | 672 | WP_278030962.1 | energy-coupling factor ABC transporter permease | - |
| P8934_RS10370 (P8934_10370) | 2161361..2161543 | + | 183 | WP_278030963.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| P8934_RS10375 (P8934_10375) | 2161561..2161965 | + | 405 | WP_133633763.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| P8934_RS10380 (P8934_10380) | 2162044..2162898 | - | 855 | WP_278030964.1 | formyltetrahydrofolate deformylase | - |
| P8934_RS10385 (P8934_10385) | 2163029..2163964 | + | 936 | WP_278030965.1 | LysR family transcriptional regulator | - |
| P8934_RS10390 (P8934_10390) | 2164076..2165110 | + | 1035 | WP_278030966.1 | TRAP transporter substrate-binding protein DctP | - |
| P8934_RS10395 (P8934_10395) | 2165186..2165677 | + | 492 | WP_278030967.1 | TRAP transporter small permease | - |
| P8934_RS10400 (P8934_10400) | 2165674..2166951 | + | 1278 | WP_278030968.1 | TRAP transporter large permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6629.74 Da Isoelectric Point: 10.6624
>T276032 WP_278030963.1 NZ_CP121193:2161361-2161543 [Halomonas sp. CKK8]
VKSSELIKELEAAGWVLDRIRGSHHVFKHPDRPGALPVPCPKKDLPKGTVHQIRKQAGLS
VKSSELIKELEAAGWVLDRIRGSHHVFKHPDRPGALPVPCPKKDLPKGTVHQIRKQAGLS
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14794.71 Da Isoelectric Point: 4.5324
>AT276032 WP_133633763.1 NZ_CP121193:2161561-2161965 [Halomonas sp. CKK8]
MQYPIAIEWGDENTATGIVFPDIPGAISAGDTPEEAYDNAVEAAHIVLQEMVARGEPVPKPGRIDEHRRNPDFEGWGWGM
IDIDLTPYLGKAEKVTVTLPGTVLRQIDEYVTLHGVKSRSTFLSNAALEKLRHL
MQYPIAIEWGDENTATGIVFPDIPGAISAGDTPEEAYDNAVEAAHIVLQEMVARGEPVPKPGRIDEHRRNPDFEGWGWGM
IDIDLTPYLGKAEKVTVTLPGTVLRQIDEYVTLHGVKSRSTFLSNAALEKLRHL
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|