Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2161361..2161965 Replicon chromosome
Accession NZ_CP121193
Organism Halomonas sp. CKK8

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag P8934_RS10370 Protein ID WP_278030963.1
Coordinates 2161361..2161543 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag P8934_RS10375 Protein ID WP_133633763.1
Coordinates 2161561..2161965 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8934_RS10345 (P8934_10345) 2156978..2157496 - 519 WP_278030959.1 L,D-transpeptidase -
P8934_RS10350 (P8934_10350) 2157496..2158164 - 669 WP_278030960.1 TetR/AcrR family transcriptional regulator -
P8934_RS10355 (P8934_10355) 2158602..2159255 + 654 WP_133633777.1 transcriptional repressor LexA -
P8934_RS10360 (P8934_10360) 2159280..2160338 + 1059 WP_278030961.1 DNA polymerase IV -
P8934_RS10365 (P8934_10365) 2160422..2161093 - 672 WP_278030962.1 energy-coupling factor ABC transporter permease -
P8934_RS10370 (P8934_10370) 2161361..2161543 + 183 WP_278030963.1 type II toxin-antitoxin system HicA family toxin Toxin
P8934_RS10375 (P8934_10375) 2161561..2161965 + 405 WP_133633763.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
P8934_RS10380 (P8934_10380) 2162044..2162898 - 855 WP_278030964.1 formyltetrahydrofolate deformylase -
P8934_RS10385 (P8934_10385) 2163029..2163964 + 936 WP_278030965.1 LysR family transcriptional regulator -
P8934_RS10390 (P8934_10390) 2164076..2165110 + 1035 WP_278030966.1 TRAP transporter substrate-binding protein DctP -
P8934_RS10395 (P8934_10395) 2165186..2165677 + 492 WP_278030967.1 TRAP transporter small permease -
P8934_RS10400 (P8934_10400) 2165674..2166951 + 1278 WP_278030968.1 TRAP transporter large permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6629.74 Da        Isoelectric Point: 10.6624

>T276032 WP_278030963.1 NZ_CP121193:2161361-2161543 [Halomonas sp. CKK8]
VKSSELIKELEAAGWVLDRIRGSHHVFKHPDRPGALPVPCPKKDLPKGTVHQIRKQAGLS

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14794.71 Da        Isoelectric Point: 4.5324

>AT276032 WP_133633763.1 NZ_CP121193:2161561-2161965 [Halomonas sp. CKK8]
MQYPIAIEWGDENTATGIVFPDIPGAISAGDTPEEAYDNAVEAAHIVLQEMVARGEPVPKPGRIDEHRRNPDFEGWGWGM
IDIDLTPYLGKAEKVTVTLPGTVLRQIDEYVTLHGVKSRSTFLSNAALEKLRHL

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References