Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 2151230..2151822 | Replicon | chromosome |
Accession | NZ_CP121193 | ||
Organism | Halomonas sp. CKK8 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | P8934_RS10310 | Protein ID | WP_278030952.1 |
Coordinates | 2151230..2151529 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | P8934_RS10315 | Protein ID | WP_278030953.1 |
Coordinates | 2151526..2151822 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8934_RS10290 (P8934_10290) | 2146829..2148409 | - | 1581 | WP_278030949.1 | acetyl-CoA hydrolase/transferase family protein | - |
P8934_RS10295 (P8934_10295) | 2148779..2149378 | - | 600 | WP_278030950.1 | inorganic diphosphatase | - |
P8934_RS10300 (P8934_10300) | 2149708..2150088 | - | 381 | Protein_2021 | phasin family protein | - |
P8934_RS10305 (P8934_10305) | 2150385..2151092 | + | 708 | WP_278030951.1 | transposase | - |
P8934_RS10310 (P8934_10310) | 2151230..2151529 | + | 300 | WP_278030952.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P8934_RS10315 (P8934_10315) | 2151526..2151822 | + | 297 | WP_278030953.1 | putative addiction module antidote protein | Antitoxin |
P8934_RS10320 (P8934_10320) | 2151897..2152163 | - | 267 | WP_278030954.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
P8934_RS10325 (P8934_10325) | 2152147..2152368 | - | 222 | WP_278030955.1 | TraY domain-containing protein | - |
P8934_RS10330 (P8934_10330) | 2152682..2153050 | - | 369 | WP_278030956.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
P8934_RS10335 (P8934_10335) | 2153480..2155276 | + | 1797 | WP_278030957.1 | type IV-A pilus assembly ATPase PilB | - |
P8934_RS10340 (P8934_10340) | 2155565..2156797 | + | 1233 | WP_278030958.1 | type II secretion system F family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11261.05 Da Isoelectric Point: 10.6190
>T276030 WP_278030952.1 NZ_CP121193:2151230-2151529 [Halomonas sp. CKK8]
MLDIKQTDTFRKWERKLRDQRAKAMIAARVFRLANGLPGDIKPVGNGISELRIHYGPGYRIYFKKRGNDIIILLCGGNKS
SQQVDIEAAKRLASEWEAS
MLDIKQTDTFRKWERKLRDQRAKAMIAARVFRLANGLPGDIKPVGNGISELRIHYGPGYRIYFKKRGNDIIILLCGGNKS
SQQVDIEAAKRLASEWEAS
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|