Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4804529..4805145 Replicon chromosome
Accession NZ_CP121189
Organism Salmonella enterica subsp. enterica serovar Indiana strain S1467

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag P6164_RS23300 Protein ID WP_000238494.1
Coordinates 4804529..4804903 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag P6164_RS23305 Protein ID WP_001523745.1
Coordinates 4804903..4805145 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6164_RS23285 (4802031) 4802031..4802933 + 903 WP_051129234.1 formate dehydrogenase subunit beta -
P6164_RS23290 (4802930) 4802930..4803565 + 636 WP_000829028.1 formate dehydrogenase cytochrome b556 subunit -
P6164_RS23295 (4803562) 4803562..4804491 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
P6164_RS23300 (4804529) 4804529..4804903 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
P6164_RS23305 (4804903) 4804903..4805145 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
P6164_RS23310 (4805350) 4805350..4806279 + 930 WP_001162861.1 alpha/beta hydrolase -
P6164_RS23315 (4806365) 4806365..4806676 + 312 WP_000558165.1 type II toxin-antitoxin system HigB family toxin -
P6164_RS23320 (4806673) 4806673..4807119 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
P6164_RS23325 (4807134) 4807134..4808075 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
P6164_RS23330 (4808120) 4808120..4808557 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
P6164_RS23335 (4808554) 4808554..4809426 - 873 WP_000921423.1 virulence factor BrkB family protein -
P6164_RS23340 (4809420) 4809420..4810019 - 600 WP_023227076.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T276028 WP_000238494.1 NZ_CP121189:c4804903-4804529 [Salmonella enterica subsp. enterica serovar Indiana]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT276028 WP_001523745.1 NZ_CP121189:c4805145-4804903 [Salmonella enterica subsp. enterica serovar Indiana]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References