Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3597308..3597928 | Replicon | chromosome |
Accession | NZ_CP121189 | ||
Organism | Salmonella enterica subsp. enterica serovar Indiana strain S1467 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | P6164_RS17640 | Protein ID | WP_001280991.1 |
Coordinates | 3597710..3597928 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | P6164_RS17635 | Protein ID | WP_000344807.1 |
Coordinates | 3597308..3597682 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6164_RS17625 (3592447) | 3592447..3593640 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P6164_RS17630 (3593663) | 3593663..3596812 | + | 3150 | WP_051129102.1 | efflux RND transporter permease AcrB | - |
P6164_RS17635 (3597308) | 3597308..3597682 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
P6164_RS17640 (3597710) | 3597710..3597928 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
P6164_RS17645 (3598107) | 3598107..3598658 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
P6164_RS17650 (3598776) | 3598776..3599246 | + | 471 | WP_000136181.1 | YlaC family protein | - |
P6164_RS17655 (3599302) | 3599302..3599442 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
P6164_RS17660 (3599448) | 3599448..3599708 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
P6164_RS17665 (3599933) | 3599933..3601483 | + | 1551 | WP_023210786.1 | EAL domain-containing protein | - |
P6164_RS17675 (3601714) | 3601714..3602103 | + | 390 | WP_000961285.1 | MGMT family protein | - |
P6164_RS17680 (3602136) | 3602136..3602705 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T276023 WP_001280991.1 NZ_CP121189:3597710-3597928 [Salmonella enterica subsp. enterica serovar Indiana]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT276023 WP_000344807.1 NZ_CP121189:3597308-3597682 [Salmonella enterica subsp. enterica serovar Indiana]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|