Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2574458..2574980 | Replicon | chromosome |
Accession | NZ_CP121189 | ||
Organism | Salmonella enterica subsp. enterica serovar Indiana strain S1467 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | P6164_RS12560 | Protein ID | WP_000221343.1 |
Coordinates | 2574696..2574980 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | P6164_RS12555 | Protein ID | WP_000885424.1 |
Coordinates | 2574458..2574706 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6164_RS12530 (2570100) | 2570100..2571566 | + | 1467 | WP_023893409.1 | hypothetical protein | - |
P6164_RS12535 (2571597) | 2571597..2571719 | - | 123 | WP_254891910.1 | hypothetical protein | - |
P6164_RS12540 (2572183) | 2572183..2572470 | + | 288 | WP_071787797.1 | helix-turn-helix domain-containing protein | - |
P6164_RS12545 (2572542) | 2572542..2573450 | - | 909 | WP_077910000.1 | hypothetical protein | - |
P6164_RS12550 (2573601) | 2573601..2573933 | - | 333 | WP_023227504.1 | DUF1493 family protein | - |
P6164_RS12555 (2574458) | 2574458..2574706 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P6164_RS12560 (2574696) | 2574696..2574980 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P6164_RS12565 (2575028) | 2575028..2575228 | + | 201 | Protein_2462 | Rid family hydrolase | - |
P6164_RS12570 (2575280) | 2575280..2576359 | - | 1080 | WP_023227502.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
P6164_RS12575 (2576552) | 2576552..2577040 | - | 489 | WP_023227501.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
P6164_RS12580 (2577085) | 2577085..2578593 | + | 1509 | WP_023227500.1 | FAD-dependent oxidoreductase | - |
P6164_RS12585 (2578583) | 2578583..2579824 | + | 1242 | WP_023227499.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2571615..2581450 | 9835 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T276021 WP_000221343.1 NZ_CP121189:2574696-2574980 [Salmonella enterica subsp. enterica serovar Indiana]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |