Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 943730..944355 | Replicon | chromosome |
| Accession | NZ_CP121189 | ||
| Organism | Salmonella enterica subsp. enterica serovar Indiana strain S1467 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P6164_RS04635 | Protein ID | WP_000911337.1 |
| Coordinates | 943957..944355 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | C0PXM4 |
| Locus tag | P6164_RS04630 | Protein ID | WP_000557545.1 |
| Coordinates | 943730..943957 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6164_RS04600 (938775) | 938775..940292 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
| P6164_RS04605 (940368) | 940368..940913 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
| P6164_RS04610 (941178) | 941178..941936 | + | 759 | WP_000244318.1 | amidase activator ActS | - |
| P6164_RS04620 (942221) | 942221..943027 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
| P6164_RS04625 (943302) | 943302..943562 | - | 261 | WP_023227725.1 | hypothetical protein | - |
| P6164_RS04630 (943730) | 943730..943957 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| P6164_RS04635 (943957) | 943957..944355 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| P6164_RS04640 (945159) | 945159..945695 | + | 537 | WP_023227726.1 | STM3031 family outer membrane protein | - |
| P6164_RS04645 (945742) | 945742..946374 | + | 633 | WP_023227727.1 | YfdX family protein | - |
| P6164_RS04650 (947093) | 947093..947680 | + | 588 | WP_023227728.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 942221..953548 | 11327 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T276015 WP_000911337.1 NZ_CP121189:943957-944355 [Salmonella enterica subsp. enterica serovar Indiana]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|