Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 932843..933503 | Replicon | chromosome |
| Accession | NZ_CP121189 | ||
| Organism | Salmonella enterica subsp. enterica serovar Indiana strain S1467 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A3V4SJP5 |
| Locus tag | P6164_RS04570 | Protein ID | WP_000244755.1 |
| Coordinates | 933090..933503 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | P6164_RS04565 | Protein ID | WP_000351186.1 |
| Coordinates | 932843..933109 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6164_RS04545 (929152) | 929152..929463 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
| P6164_RS04550 (929627) | 929627..930286 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
| P6164_RS04555 (930544) | 930544..931530 | + | 987 | WP_023226548.1 | IS110 family transposase | - |
| P6164_RS04560 (931613) | 931613..932593 | - | 981 | WP_017441090.1 | tRNA-modifying protein YgfZ | - |
| P6164_RS04565 (932843) | 932843..933109 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| P6164_RS04570 (933090) | 933090..933503 | + | 414 | WP_000244755.1 | protein YgfX | Toxin |
| P6164_RS04575 (933556) | 933556..934077 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
| P6164_RS04580 (934190) | 934190..935086 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| P6164_RS04585 (935110) | 935110..935823 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| P6164_RS04590 (935829) | 935829..937562 | + | 1734 | WP_023227724.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16164.10 Da Isoelectric Point: 10.2118
>T276014 WP_000244755.1 NZ_CP121189:933090-933503 [Salmonella enterica subsp. enterica serovar Indiana]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLHPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLHPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V4SJP5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |