Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 692506..693347 | Replicon | chromosome |
| Accession | NZ_CP121189 | ||
| Organism | Salmonella enterica subsp. enterica serovar Indiana strain S1467 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1M0WJM1 |
| Locus tag | P6164_RS03335 | Protein ID | WP_000854822.1 |
| Coordinates | 692964..693347 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MK11 |
| Locus tag | P6164_RS03330 | Protein ID | WP_001285610.1 |
| Coordinates | 692506..692874 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6164_RS03310 (690250) | 690250..691068 | + | 819 | WP_001234702.1 | DUF932 domain-containing protein | - |
| P6164_RS03315 (691159) | 691159..691644 | + | 486 | WP_072794436.1 | antirestriction protein | - |
| P6164_RS03320 (691660) | 691660..692136 | + | 477 | WP_072661507.1 | RadC family protein | - |
| P6164_RS03325 (692205) | 692205..692426 | + | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| P6164_RS03330 (692506) | 692506..692874 | + | 369 | WP_001285610.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| P6164_RS03335 (692964) | 692964..693347 | + | 384 | WP_000854822.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| P6164_RS03340 (693338) | 693338..693826 | + | 489 | WP_001177592.1 | DUF5983 family protein | - |
| P6164_RS03345 (693793) | 693793..694035 | + | 243 | WP_166635458.1 | DUF957 domain-containing protein | - |
| P6164_RS03350 (694132) | 694132..694977 | + | 846 | WP_001280435.1 | DUF4942 domain-containing protein | - |
| P6164_RS03360 (695277) | 695277..695783 | + | 507 | WP_000237776.1 | G/U mismatch-specific DNA glycosylase | - |
| P6164_RS03365 (695907) | 695907..697754 | - | 1848 | WP_001519776.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14295.32 Da Isoelectric Point: 8.2830
>T276013 WP_000854822.1 NZ_CP121189:692964-693347 [Salmonella enterica subsp. enterica serovar Indiana]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
Download Length: 384 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13606.39 Da Isoelectric Point: 6.0618
>AT276013 WP_001285610.1 NZ_CP121189:692506-692874 [Salmonella enterica subsp. enterica serovar Indiana]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|