Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
| Location | 1138124..1139232 | Replicon | chromosome |
| Accession | NZ_CP121160 | ||
| Organism | Streptococcus agalactiae strain S5 | ||
Toxin (Protein)
| Gene name | MNTss | Uniprot ID | - |
| Locus tag | P8R99_RS05865 | Protein ID | WP_046391877.1 |
| Coordinates | 1138124..1138993 (-) | Length | 290 a.a. |
Antitoxin (Protein)
| Gene name | Xress | Uniprot ID | B9DSK1 |
| Locus tag | P8R99_RS05870 | Protein ID | WP_002303393.1 |
| Coordinates | 1139008..1139232 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8R99_RS05830 | 1133126..1133929 | - | 804 | WP_000140980.1 | ABC transporter ATP-binding protein | - |
| P8R99_RS05835 | 1133941..1134762 | - | 822 | WP_017646958.1 | ABC transporter permease | - |
| P8R99_RS05840 | 1134759..1135181 | - | 423 | Protein_1127 | ABC transporter permease | - |
| P8R99_RS05845 | 1135232..1135912 | - | 681 | WP_278043276.1 | IS6-like element IS1216 family transposase | - |
| P8R99_RS05850 | 1135966..1136469 | - | 504 | WP_278043396.1 | phosphoribosyltransferase family protein | - |
| P8R99_RS05855 | 1136513..1137376 | - | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
| P8R99_RS05860 | 1137409..1138143 | - | 735 | WP_010725595.1 | class I SAM-dependent methyltransferase | - |
| P8R99_RS05865 | 1138124..1138993 | - | 870 | WP_046391877.1 | nucleotidyltransferase domain-containing protein | Toxin |
| P8R99_RS05870 | 1139008..1139232 | - | 225 | WP_002303393.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| P8R99_RS05875 | 1139313..1139786 | - | 474 | WP_226316671.1 | GrpB family protein | - |
| P8R99_RS05880 | 1139904..1141367 | - | 1464 | WP_216806948.1 | ABC-F type ribosomal protection protein Msr(D) | - |
| P8R99_RS05885 | 1141487..1142704 | - | 1218 | WP_159373770.1 | macrolide efflux MFS transporter Mef(A) | - |
| P8R99_RS05890 | 1143240..1143874 | - | 635 | Protein_1137 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | ant(6)-Ia / msr(D) / mef(A) / lnu(D) | - | 1035145..1152937 | 117792 | |
| - | inside | IS/Tn | ant(6)-Ia / msr(D) / mef(A) / lnu(D) | - | 1135232..1144853 | 9621 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32829.52 Da Isoelectric Point: 4.8826
>T276011 WP_046391877.1 NZ_CP121160:c1138993-1138124 [Streptococcus agalactiae]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDENRNNLVVPPGAWGDW
VNGGGWLVINGCHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGAEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVKEIATEINNFLNEENLNERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDENRNNLVVPPGAWGDW
VNGGGWLVINGCHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGAEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVKEIATEINNFLNEENLNERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|