Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1045305..1045917 | Replicon | chromosome |
| Accession | NZ_CP121160 | ||
| Organism | Streptococcus agalactiae strain S5 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q8E7D3 |
| Locus tag | P8R99_RS05360 | Protein ID | WP_000384859.1 |
| Coordinates | 1045582..1045917 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q8E7D2 |
| Locus tag | P8R99_RS05355 | Protein ID | WP_000259017.1 |
| Coordinates | 1045305..1045592 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8R99_RS05335 | 1040378..1042279 | + | 1902 | WP_278043367.1 | DUF4013 domain-containing protein | - |
| P8R99_RS05340 | 1042282..1043385 | + | 1104 | WP_017648212.1 | CHAP domain-containing protein | - |
| P8R99_RS05345 | 1043407..1043673 | + | 267 | WP_017648213.1 | helix-turn-helix domain-containing protein | - |
| P8R99_RS05350 | 1043686..1044903 | + | 1218 | WP_017648214.1 | tyrosine-type recombinase/integrase | - |
| P8R99_RS05355 | 1045305..1045592 | + | 288 | WP_000259017.1 | hypothetical protein | Antitoxin |
| P8R99_RS05360 | 1045582..1045917 | + | 336 | WP_000384859.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8R99_RS05365 | 1046222..1046692 | - | 471 | WP_000130119.1 | hypothetical protein | - |
| P8R99_RS05370 | 1046860..1048116 | - | 1257 | WP_000122836.1 | MobV family relaxase | - |
| P8R99_RS05375 | 1048433..1048867 | - | 435 | WP_001220479.1 | hypothetical protein | - |
| P8R99_RS05380 | 1048903..1049778 | - | 876 | WP_000421240.1 | hypothetical protein | - |
| P8R99_RS05385 | 1050078..1050719 | - | 642 | WP_000591144.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | ant(6)-Ia / msr(D) / mef(A) / lnu(D) | - | 1035145..1152937 | 117792 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13296.98 Da Isoelectric Point: 4.6565
>T276010 WP_000384859.1 NZ_CP121160:1045582-1045917 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|