Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 1108122..1109230 | Replicon | chromosome |
Accession | NZ_CP121159 | ||
Organism | Streptococcus agalactiae strain S1 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | R3JIN1 |
Locus tag | P8R98_RS05585 | Protein ID | WP_000233000.1 |
Coordinates | 1108122..1108991 (-) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | P8R98_RS05590 | Protein ID | WP_000205227.1 |
Coordinates | 1109006..1109230 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8R98_RS05565 | 1104393..1105712 | - | 1320 | WP_002338419.1 | IS1380-like element ISSsu5 family transposase | - |
P8R98_RS05570 | 1105940..1106467 | - | 528 | WP_002294507.1 | phosphoribosyltransferase family protein | - |
P8R98_RS05575 | 1106511..1107374 | - | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
P8R98_RS05580 | 1107407..1108141 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
P8R98_RS05585 | 1108122..1108991 | - | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
P8R98_RS05590 | 1109006..1109230 | - | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
P8R98_RS05595 | 1109373..1110917 | - | 1545 | WP_002390960.1 | recombinase family protein | - |
P8R98_RS05600 | 1110937..1111353 | - | 417 | WP_000323438.1 | recombinase | - |
P8R98_RS05605 | 1111354..1111851 | - | 498 | WP_002327635.1 | DNA recombinase | - |
P8R98_RS05610 | 1112265..1113290 | + | 1026 | WP_278043520.1 | lanthionine synthetase LanC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | ant(6)-Ia / tet(M) | - | 1073875..1174187 | 100312 | |
- | flank | IS/Tn | ant(6)-Ia | - | 1104393..1107374 | 2981 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T276006 WP_000233000.1 NZ_CP121159:c1108991-1108122 [Streptococcus agalactiae]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|