276004

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 92037..92596 Replicon plasmid pE89-1
Accession NZ_CP121158
Organism Escherichia coli strain E89

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag P6H86_RS24065 Protein ID WP_000421272.1
Coordinates 92037..92312 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag P6H86_RS24070 Protein ID WP_001387467.1
Coordinates 92312..92596 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6H86_RS24030 (87611) 87611..87793 - 183 WP_042344623.1 hypothetical protein -
P6H86_RS24035 (87860) 87860..88149 - 290 Protein_104 type II toxin-antitoxin system RelE/ParE family toxin -
P6H86_RS24040 (88136) 88136..88404 - 269 Protein_105 type II toxin-antitoxin system ParD family antitoxin -
P6H86_RS24045 (88565) 88565..89793 + 1229 WP_113708090.1 IS3-like element IS2 family transposase -
P6H86_RS24050 (90272) 90272..91186 + 915 WP_223429136.1 hypothetical protein -
P6H86_RS24055 (91475) 91475..91603 + 129 Protein_108 IS481 family transposase -
P6H86_RS24060 (91728) 91728..91931 - 204 Protein_109 hypothetical protein -
P6H86_RS24065 (92037) 92037..92312 - 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P6H86_RS24070 (92312) 92312..92596 - 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
P6H86_RS24075 (93201) 93201..93953 + 753 WP_000562172.1 IclR family transcriptional regulator -
P6H86_RS24080 (93999) 93999..94268 - 270 Protein_113 2-keto-3-deoxygluconate permease -
P6H86_RS24085 (94329) 94329..95033 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
P6H86_RS24090 (95122) 95122..95538 + 417 WP_077767144.1 conjugal transfer pilus-stabilizing protein TraP -
P6H86_RS24095 (95525) 95525..95845 + 321 WP_001057307.1 conjugal transfer protein TrbD -
P6H86_RS24100 (95842) 95842..96357 + 516 WP_000809881.1 type IV conjugative transfer system lipoprotein TraV -
P6H86_RS24105 (96492) 96492..96713 + 222 WP_001278683.1 conjugal transfer protein TraR -
P6H86_RS24110 (96706) 96706..97119 + 414 WP_000549589.1 hypothetical protein -
P6H86_RS24115 (97112) 97112..97585 + 474 WP_000549568.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid erm(42) / ant(3'')-Ia / sitABCD / fosA3 / blaTEM-1B / blaCTX-M-55 / aac(3)-IId / mph(A) iutA / iucD / iucC / iucB / iucA 1..159910 159910
- inside IScluster/Tn sitABCD - 77369..95033 17664


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T276004 WP_000421272.1 NZ_CP121158:c92312-92037 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT276004 WP_001387467.1 NZ_CP121158:c92596-92312 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References