Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 61445..62088 | Replicon | plasmid pE89-1 |
Accession | NZ_CP121158 | ||
Organism | Escherichia coli strain E89 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | P6H86_RS23900 | Protein ID | WP_001034044.1 |
Coordinates | 61672..62088 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | P6H86_RS23895 | Protein ID | WP_001261286.1 |
Coordinates | 61445..61675 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H86_RS23880 (56582) | 56582..56812 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
P6H86_RS23885 (56809) | 56809..57225 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
P6H86_RS23890 (57270) | 57270..61064 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
P6H86_RS23895 (61445) | 61445..61675 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
P6H86_RS23900 (61672) | 61672..62088 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P6H86_RS23905 (62163) | 62163..63728 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
P6H86_RS23910 (63713) | 63713..64735 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | erm(42) / ant(3'')-Ia / sitABCD / fosA3 / blaTEM-1B / blaCTX-M-55 / aac(3)-IId / mph(A) | iutA / iucD / iucC / iucB / iucA | 1..159910 | 159910 | |
- | flank | IS/Tn | - | - | 64989..65492 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T276003 WP_001034044.1 NZ_CP121158:61672-62088 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |