Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 56582..57225 | Replicon | plasmid pE89-1 |
| Accession | NZ_CP121158 | ||
| Organism | Escherichia coli strain E89 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | C7S9Y5 |
| Locus tag | P6H86_RS23885 | Protein ID | WP_001034046.1 |
| Coordinates | 56809..57225 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | V0SR71 |
| Locus tag | P6H86_RS23880 | Protein ID | WP_001261278.1 |
| Coordinates | 56582..56812 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H86_RS23840 (51646) | 51646..51834 | - | 189 | WP_000957857.1 | hypothetical protein | - |
| P6H86_RS23845 (51951) | 51951..52091 | - | 141 | Protein_66 | hypothetical protein | - |
| P6H86_RS23850 (52092) | 52092..52397 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | - |
| P6H86_RS23855 (52399) | 52399..52617 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| P6H86_RS23860 (53209) | 53209..53697 | + | 489 | WP_011254646.1 | hypothetical protein | - |
| P6H86_RS23865 (53731) | 53731..54864 | - | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
| P6H86_RS23870 (55031) | 55031..55804 | - | 774 | WP_000905949.1 | hypothetical protein | - |
| P6H86_RS23875 (55817) | 55817..56317 | - | 501 | WP_000528931.1 | HEPN family nuclease | - |
| P6H86_RS23880 (56582) | 56582..56812 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P6H86_RS23885 (56809) | 56809..57225 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P6H86_RS23890 (57270) | 57270..61064 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
| P6H86_RS23895 (61445) | 61445..61675 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| P6H86_RS23900 (61672) | 61672..62088 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | erm(42) / ant(3'')-Ia / sitABCD / fosA3 / blaTEM-1B / blaCTX-M-55 / aac(3)-IId / mph(A) | iutA / iucD / iucC / iucB / iucA | 1..159910 | 159910 | |
| - | flank | IS/Tn | - | - | 50437..51636 | 1199 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T276002 WP_001034046.1 NZ_CP121158:56809-57225 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9NXF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SR71 |