Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 56582..57225 Replicon plasmid pE89-1
Accession NZ_CP121158
Organism Escherichia coli strain E89

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag P6H86_RS23885 Protein ID WP_001034046.1
Coordinates 56809..57225 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag P6H86_RS23880 Protein ID WP_001261278.1
Coordinates 56582..56812 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6H86_RS23840 (51646) 51646..51834 - 189 WP_000957857.1 hypothetical protein -
P6H86_RS23845 (51951) 51951..52091 - 141 Protein_66 hypothetical protein -
P6H86_RS23850 (52092) 52092..52397 - 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -
P6H86_RS23855 (52399) 52399..52617 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
P6H86_RS23860 (53209) 53209..53697 + 489 WP_011254646.1 hypothetical protein -
P6H86_RS23865 (53731) 53731..54864 - 1134 WP_001542067.1 DUF3800 domain-containing protein -
P6H86_RS23870 (55031) 55031..55804 - 774 WP_000905949.1 hypothetical protein -
P6H86_RS23875 (55817) 55817..56317 - 501 WP_000528931.1 HEPN family nuclease -
P6H86_RS23880 (56582) 56582..56812 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
P6H86_RS23885 (56809) 56809..57225 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
P6H86_RS23890 (57270) 57270..61064 - 3795 WP_001144732.1 hypothetical protein -
P6H86_RS23895 (61445) 61445..61675 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
P6H86_RS23900 (61672) 61672..62088 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid erm(42) / ant(3'')-Ia / sitABCD / fosA3 / blaTEM-1B / blaCTX-M-55 / aac(3)-IId / mph(A) iutA / iucD / iucC / iucB / iucA 1..159910 159910
- flank IS/Tn - - 50437..51636 1199


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T276002 WP_001034046.1 NZ_CP121158:56809-57225 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT276002 WP_001261278.1 NZ_CP121158:56582-56812 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References