Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 52092..52617 | Replicon | plasmid pE89-1 |
Accession | NZ_CP121158 | ||
Organism | Escherichia coli strain E89 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | P6H86_RS23850 | Protein ID | WP_001159868.1 |
Coordinates | 52092..52397 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | P6H86_RS23855 | Protein ID | WP_000813634.1 |
Coordinates | 52399..52617 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H86_RS23825 (48122) | 48122..48877 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
P6H86_RS23830 (49597) | 49597..50265 | - | 669 | Protein_63 | site-specific integrase | - |
P6H86_RS23835 (50437) | 50437..51636 | - | 1200 | WP_112901278.1 | IS91 family transposase | - |
P6H86_RS23840 (51646) | 51646..51834 | - | 189 | WP_000957857.1 | hypothetical protein | - |
P6H86_RS23845 (51951) | 51951..52091 | - | 141 | Protein_66 | hypothetical protein | - |
P6H86_RS23850 (52092) | 52092..52397 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
P6H86_RS23855 (52399) | 52399..52617 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
P6H86_RS23860 (53209) | 53209..53697 | + | 489 | WP_011254646.1 | hypothetical protein | - |
P6H86_RS23865 (53731) | 53731..54864 | - | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
P6H86_RS23870 (55031) | 55031..55804 | - | 774 | WP_000905949.1 | hypothetical protein | - |
P6H86_RS23875 (55817) | 55817..56317 | - | 501 | WP_000528931.1 | HEPN family nuclease | - |
P6H86_RS23880 (56582) | 56582..56812 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
P6H86_RS23885 (56809) | 56809..57225 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | erm(42) / ant(3'')-Ia / sitABCD / fosA3 / blaTEM-1B / blaCTX-M-55 / aac(3)-IId / mph(A) | iutA / iucD / iucC / iucB / iucA | 1..159910 | 159910 | |
- | flank | IS/Tn | - | - | 50437..51636 | 1199 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T276001 WP_001159868.1 NZ_CP121158:c52397-52092 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|