Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4249640..4250475 Replicon chromosome
Accession NZ_CP121157
Organism Escherichia coli strain E89

Toxin (Protein)


Gene name yeeV Uniprot ID A0A7W4PV54
Locus tag P6H86_RS21015 Protein ID WP_000854821.1
Coordinates 4250098..4250475 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag P6H86_RS21010 Protein ID WP_032216526.1
Coordinates 4249640..4250008 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6H86_RS20970 (4244763) 4244763..4245647 + 885 WP_032216515.1 50S ribosome-binding GTPase -
P6H86_RS20975 (4245766) 4245766..4246443 + 678 WP_001097364.1 hypothetical protein -
P6H86_RS20980 (4246449) 4246449..4246682 + 234 WP_001278282.1 DUF905 family protein -
P6H86_RS20985 (4246781) 4246781..4247599 + 819 WP_053902307.1 DUF932 domain-containing protein -
P6H86_RS20990 (4247691) 4247691..4248176 + 486 WP_032216512.1 antirestriction protein -
P6H86_RS20995 (4248192) 4248192..4248668 + 477 WP_001186724.1 RadC family protein -
P6H86_RS21000 (4248737) 4248737..4248958 + 222 WP_001601167.1 DUF987 domain-containing protein -
P6H86_RS21005 (4248977) 4248977..4249621 + 645 Protein_4105 antitoxin of toxin-antitoxin stability system -
P6H86_RS21010 (4249640) 4249640..4250008 + 369 WP_032216526.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
P6H86_RS21015 (4250098) 4250098..4250475 + 378 WP_000854821.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
P6H86_RS21020 (4250472) 4250472..4250621 + 150 Protein_4108 DUF5983 family protein -
P6H86_RS21025 (4250697) 4250697..4250894 + 198 WP_023563519.1 DUF957 domain-containing protein -
P6H86_RS21030 (4250979) 4250979..4251821 + 843 WP_001280501.1 DUF4942 domain-containing protein -
P6H86_RS21040 (4253347) 4253347..4254885 + 1539 WP_001187173.1 lysine decarboxylation/transport transcriptional activator CadC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 4252337..4252840 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13930.95 Da        Isoelectric Point: 8.5163

>T275995 WP_000854821.1 NZ_CP121157:4250098-4250475 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13810.69 Da        Isoelectric Point: 6.2066

>AT275995 WP_032216526.1 NZ_CP121157:4249640-4250008 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLLCTVTPCFGARLVQEGNRLHYLVDRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W4PV54

Antitoxin

Source ID Structure

References