Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2244175..2244813 | Replicon | chromosome |
Accession | NZ_CP121157 | ||
Organism | Escherichia coli strain E89 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | P6H86_RS11045 | Protein ID | WP_000813794.1 |
Coordinates | 2244175..2244351 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | P6H86_RS11050 | Protein ID | WP_001270286.1 |
Coordinates | 2244397..2244813 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H86_RS11025 (2239794) | 2239794..2240969 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
P6H86_RS11030 (2241061) | 2241061..2241597 | + | 537 | WP_219383084.1 | DNA-binding transcriptional regulator SutR | - |
P6H86_RS11035 (2241670) | 2241670..2243631 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
P6H86_RS11040 (2243723) | 2243723..2243953 | - | 231 | WP_000494244.1 | YncJ family protein | - |
P6H86_RS11045 (2244175) | 2244175..2244351 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
P6H86_RS11050 (2244397) | 2244397..2244813 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
P6H86_RS11055 (2244892) | 2244892..2246298 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
P6H86_RS11060 (2246543) | 2246543..2247688 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
P6H86_RS11065 (2247706) | 2247706..2248719 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
P6H86_RS11070 (2248720) | 2248720..2249661 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T275988 WP_000813794.1 NZ_CP121157:2244175-2244351 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT275988 WP_001270286.1 NZ_CP121157:2244397-2244813 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|