Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 41757..42400 | Replicon | plasmid pE67-1 |
| Accession | NZ_CP121156 | ||
| Organism | Escherichia coli strain E67 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | P6H85_RS24000 | Protein ID | WP_001044768.1 |
| Coordinates | 41757..42173 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | P6H85_RS24005 | Protein ID | WP_001261287.1 |
| Coordinates | 42170..42400 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H85_RS23985 (38256) | 38256..38846 | - | 591 | WP_000194575.1 | hypothetical protein | - |
| P6H85_RS23990 (38846) | 38846..39103 | - | 258 | WP_000343085.1 | hypothetical protein | - |
| P6H85_RS23995 (39457) | 39457..41595 | + | 2139 | WP_000350638.1 | AAA family ATPase | - |
| P6H85_RS24000 (41757) | 41757..42173 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P6H85_RS24005 (42170) | 42170..42400 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P6H85_RS24010 (42696) | 42696..42986 | + | 291 | WP_000111771.1 | hypothetical protein | - |
| P6H85_RS24015 (42976) | 42976..43875 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
| P6H85_RS24020 (43925) | 43925..46150 | - | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
| P6H85_RS24025 (46152) | 46152..47240 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-27 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aph(3')-Ia / tet(A) / mph(A) / dfrA14 | - | 1..124410 | 124410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T275972 WP_001044768.1 NZ_CP121156:c42173-41757 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |