Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4705656..4706272 | Replicon | chromosome |
Accession | NZ_CP121155 | ||
Organism | Escherichia coli strain E67 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A176ZIX8 |
Locus tag | P6H85_RS22695 | Protein ID | WP_001129490.1 |
Coordinates | 4705656..4706030 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1M0CY48 |
Locus tag | P6H85_RS22700 | Protein ID | WP_001275523.1 |
Coordinates | 4706030..4706272 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H85_RS22680 (4703159) | 4703159..4704061 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
P6H85_RS22685 (4704058) | 4704058..4704693 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
P6H85_RS22690 (4704690) | 4704690..4705619 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
P6H85_RS22695 (4705656) | 4705656..4706030 | - | 375 | WP_001129490.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P6H85_RS22700 (4706030) | 4706030..4706272 | - | 243 | WP_001275523.1 | CopG family transcriptional regulator | Antitoxin |
P6H85_RS22705 (4706492) | 4706492..4706710 | - | 219 | WP_001251290.1 | CopG family transcriptional regulator | - |
P6H85_RS22710 (4707384) | 4707384..4708298 | - | 915 | WP_072649161.1 | transposase | - |
P6H85_RS22715 (4708311) | 4708311..4709198 | - | 888 | Protein_4442 | hypothetical protein | - |
P6H85_RS22720 (4709614) | 4709614..4710555 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
P6H85_RS22725 (4710600) | 4710600..4711037 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13960.19 Da Isoelectric Point: 7.0126
>T275971 WP_001129490.1 NZ_CP121155:c4706030-4705656 [Escherichia coli]
MAKRTALFDTNILIDLFSGRIEAKQALEAWPLQNAISLVTWMEVLVGAKKYDQEHRTRIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVVTPYEL
MAKRTALFDTNILIDLFSGRIEAKQALEAWPLQNAISLVTWMEVLVGAKKYDQEHRTRIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVVTPYEL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A176ZIX8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0CY48 |