Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4274667..4275189 | Replicon | chromosome |
Accession | NZ_CP121155 | ||
Organism | Escherichia coli strain E67 |
Toxin (Protein)
Gene name | relE | Uniprot ID | V0SDB6 |
Locus tag | P6H85_RS20680 | Protein ID | WP_001105432.1 |
Coordinates | 4274667..4274957 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V0SC69 |
Locus tag | P6H85_RS20685 | Protein ID | WP_000212715.1 |
Coordinates | 4274947..4275189 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H85_RS20665 (4269830) | 4269830..4271485 | + | 1656 | WP_001361372.1 | alpha,alpha-phosphotrehalase | - |
P6H85_RS20670 (4271879) | 4271879..4274017 | + | 2139 | WP_000187798.1 | anaerobic ribonucleoside-triphosphate reductase | - |
P6H85_RS20675 (4274202) | 4274202..4274666 | + | 465 | WP_001009180.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
P6H85_RS20680 (4274667) | 4274667..4274957 | - | 291 | WP_001105432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P6H85_RS20685 (4274947) | 4274947..4275189 | - | 243 | WP_000212715.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P6H85_RS20690 (4275381) | 4275381..4275767 | - | 387 | WP_001232253.1 | cytochrome b562 | - |
P6H85_RS20695 (4275823) | 4275823..4277175 | - | 1353 | WP_001162172.1 | metalloprotease PmbA | - |
P6H85_RS20700 (4277269) | 4277269..4277820 | + | 552 | WP_000166270.1 | ribosome biogenesis factor YjgA | - |
P6H85_RS20705 (4277903) | 4277903..4279276 | - | 1374 | WP_001219814.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11311.21 Da Isoelectric Point: 10.0238
>T275968 WP_001105432.1 NZ_CP121155:c4274957-4274667 [Escherichia coli]
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTLGYRLVYSVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTLGYRLVYSVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SDB6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9H4B3 |