Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1106553..1107136 | Replicon | chromosome |
Accession | NZ_CP121155 | ||
Organism | Escherichia coli strain E67 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | P6H85_RS05325 | Protein ID | WP_000254738.1 |
Coordinates | 1106801..1107136 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A1M2IZI3 |
Locus tag | P6H85_RS05320 | Protein ID | WP_000581940.1 |
Coordinates | 1106553..1106801 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H85_RS05310 (1102892) | 1102892..1104193 | + | 1302 | WP_000046818.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
P6H85_RS05315 (1104241) | 1104241..1106475 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
P6H85_RS05320 (1106553) | 1106553..1106801 | + | 249 | WP_000581940.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
P6H85_RS05325 (1106801) | 1106801..1107136 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
P6H85_RS05330 (1107208) | 1107208..1107999 | + | 792 | WP_001071641.1 | nucleoside triphosphate pyrophosphohydrolase | - |
P6H85_RS05335 (1108227) | 1108227..1109864 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
P6H85_RS05340 (1109951) | 1109951..1111249 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T275956 WP_000254738.1 NZ_CP121155:1106801-1107136 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|