Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1004906..1005560 | Replicon | chromosome |
Accession | NZ_CP121155 | ||
Organism | Escherichia coli strain E67 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4T2L4 |
Locus tag | P6H85_RS04875 | Protein ID | WP_000244765.1 |
Coordinates | 1005153..1005560 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | P6H85_RS04870 | Protein ID | WP_000354046.1 |
Coordinates | 1004906..1005172 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H85_RS04850 (1000994) | 1000994..1002427 | - | 1434 | WP_063082439.1 | 6-phospho-beta-glucosidase BglA | - |
P6H85_RS04855 (1002472) | 1002472..1002783 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
P6H85_RS04860 (1002947) | 1002947..1003606 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
P6H85_RS04865 (1003683) | 1003683..1004663 | - | 981 | WP_049038218.1 | tRNA-modifying protein YgfZ | - |
P6H85_RS04870 (1004906) | 1004906..1005172 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
P6H85_RS04875 (1005153) | 1005153..1005560 | + | 408 | WP_000244765.1 | protein YgfX | Toxin |
P6H85_RS04880 (1005600) | 1005600..1006121 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
P6H85_RS04885 (1006233) | 1006233..1007129 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
P6H85_RS04890 (1007154) | 1007154..1007864 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P6H85_RS04895 (1007870) | 1007870..1009603 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T275955 WP_000244765.1 NZ_CP121155:1005153-1005560 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A454A7D7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |