Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 878551..879383 | Replicon | chromosome |
| Accession | NZ_CP121155 | ||
| Organism | Escherichia coli strain E67 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | P6H85_RS04195 | Protein ID | WP_000854753.1 |
| Coordinates | 878551..878925 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | P6H85_RS04200 | Protein ID | WP_219412244.1 |
| Coordinates | 879015..879383 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H85_RS04165 (873814) | 873814..874170 | + | 357 | WP_032165636.1 | Arm DNA-binding domain-containing protein | - |
| P6H85_RS04170 (874225) | 874225..875409 | - | 1185 | WP_023892874.1 | site-specific integrase | - |
| P6H85_RS04175 (875755) | 875755..876288 | - | 534 | WP_077252454.1 | hypothetical protein | - |
| P6H85_RS04180 (877189) | 877189..877760 | - | 572 | Protein_822 | DUF4942 domain-containing protein | - |
| P6H85_RS04185 (877857) | 877857..878054 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| P6H85_RS04190 (878066) | 878066..878554 | - | 489 | WP_000777545.1 | DUF5983 family protein | - |
| P6H85_RS04195 (878551) | 878551..878925 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| P6H85_RS04200 (879015) | 879015..879383 | - | 369 | WP_219412244.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| P6H85_RS04205 (879546) | 879546..879767 | - | 222 | WP_001405861.1 | DUF987 domain-containing protein | - |
| P6H85_RS04210 (879836) | 879836..880312 | - | 477 | WP_001186724.1 | RadC family protein | - |
| P6H85_RS04215 (880328) | 880328..880813 | - | 486 | WP_112917491.1 | antirestriction protein | - |
| P6H85_RS04220 (880868) | 880868..881686 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| P6H85_RS04225 (881786) | 881786..882019 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| P6H85_RS04230 (882098) | 882098..882553 | - | 456 | WP_072645706.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T275954 WP_000854753.1 NZ_CP121155:c878925-878551 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13680.51 Da Isoelectric Point: 6.8270
>AT275954 WP_219412244.1 NZ_CP121155:c879383-879015 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADHAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADHAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|