Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 13453..14096 | Replicon | plasmid pE57-1 |
| Accession | NZ_CP121154 | ||
| Organism | Escherichia coli strain E57 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | P6H84_RS23985 | Protein ID | WP_001044768.1 |
| Coordinates | 13680..14096 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | P6H84_RS23980 | Protein ID | WP_001261287.1 |
| Coordinates | 13453..13683 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H84_RS23960 (8613) | 8613..9701 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
| P6H84_RS23965 (9703) | 9703..11928 | + | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
| P6H84_RS23970 (11978) | 11978..12877 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
| P6H84_RS23975 (12867) | 12867..13157 | - | 291 | WP_000111771.1 | hypothetical protein | - |
| P6H84_RS23980 (13453) | 13453..13683 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P6H84_RS23985 (13680) | 13680..14096 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P6H84_RS23990 (14258) | 14258..16396 | - | 2139 | WP_000350638.1 | AAA family ATPase | - |
| P6H84_RS23995 (16750) | 16750..17007 | + | 258 | WP_000343085.1 | hypothetical protein | - |
| P6H84_RS24000 (17007) | 17007..17597 | + | 591 | WP_000194575.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aph(3')-Ia / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / blaCTX-M-27 / dfrA14 / mph(A) | - | 1..124410 | 124410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T275946 WP_001044768.1 NZ_CP121154:13680-14096 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |