Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 3696501..3697338 | Replicon | chromosome |
| Accession | NZ_CP121153 | ||
| Organism | Escherichia coli strain E57 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | A0A1M0D5U3 |
| Locus tag | P6H84_RS17985 | Protein ID | WP_000227782.1 |
| Coordinates | 3696796..3697338 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | B1LJI1 |
| Locus tag | P6H84_RS17980 | Protein ID | WP_001353405.1 |
| Coordinates | 3696501..3696812 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H84_RS17955 (3691521) | 3691521..3692468 | + | 948 | WP_001239437.1 | cytochrome o ubiquinol oxidase subunit II | - |
| P6H84_RS17960 (3692490) | 3692490..3694481 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| P6H84_RS17965 (3694471) | 3694471..3695085 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| P6H84_RS17970 (3695085) | 3695085..3695414 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| P6H84_RS17975 (3695426) | 3695426..3696316 | + | 891 | WP_000971327.1 | heme o synthase | - |
| P6H84_RS17980 (3696501) | 3696501..3696812 | + | 312 | WP_001353405.1 | DUF1778 domain-containing protein | Antitoxin |
| P6H84_RS17985 (3696796) | 3696796..3697338 | + | 543 | WP_000227782.1 | GNAT family N-acetyltransferase | Toxin |
| P6H84_RS17990 (3697394) | 3697394..3698238 | - | 845 | Protein_3524 | tetratricopeptide repeat protein | - |
| P6H84_RS17995 (3698645) | 3698645..3700009 | + | 1365 | WP_001000978.1 | MFS transporter | - |
| P6H84_RS18000 (3700137) | 3700137..3700628 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| P6H84_RS18005 (3700796) | 3700796..3701707 | + | 912 | WP_000705841.1 | 2-dehydropantoate 2-reductase | - |
| P6H84_RS18010 (3701670) | 3701670..3702260 | + | 591 | WP_001276320.1 | protein deglycase YajL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19957.31 Da Isoelectric Point: 9.1763
>T275940 WP_000227782.1 NZ_CP121153:3696796-3697338 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDIIYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCNFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDIIYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCNFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M0D5U3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G7G3 |