Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3662411..3663029 | Replicon | chromosome |
Accession | NZ_CP121153 | ||
Organism | Escherichia coli strain E57 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | P6H84_RS17815 | Protein ID | WP_001291435.1 |
Coordinates | 3662811..3663029 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | P6H84_RS17810 | Protein ID | WP_000344800.1 |
Coordinates | 3662411..3662785 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H84_RS17800 (3657500) | 3657500..3658693 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P6H84_RS17805 (3658716) | 3658716..3661865 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
P6H84_RS17810 (3662411) | 3662411..3662785 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
P6H84_RS17815 (3662811) | 3662811..3663029 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
P6H84_RS17820 (3663201) | 3663201..3663752 | + | 552 | WP_000102574.1 | maltose O-acetyltransferase | - |
P6H84_RS17825 (3663868) | 3663868..3664338 | + | 471 | WP_000136192.1 | YlaC family protein | - |
P6H84_RS17830 (3664502) | 3664502..3666052 | + | 1551 | WP_001361689.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
P6H84_RS17835 (3666094) | 3666094..3666447 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
P6H84_RS17845 (3666826) | 3666826..3667137 | + | 312 | WP_000409911.1 | MGMT family protein | - |
P6H84_RS17850 (3667168) | 3667168..3667740 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T275939 WP_001291435.1 NZ_CP121153:3662811-3663029 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT275939 WP_000344800.1 NZ_CP121153:3662411-3662785 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |