Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3235990..3236695 | Replicon | chromosome |
Accession | NZ_CP121153 | ||
Organism | Escherichia coli strain E57 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1M2J6W7 |
Locus tag | P6H84_RS15660 | Protein ID | WP_000539524.1 |
Coordinates | 3235990..3236376 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P6H84_RS15665 | Protein ID | WP_001280945.1 |
Coordinates | 3236366..3236695 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H84_RS15640 (3231994) | 3231994..3232620 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
P6H84_RS15645 (3232617) | 3232617..3233732 | - | 1116 | WP_000555056.1 | aldose sugar dehydrogenase YliI | - |
P6H84_RS15650 (3233843) | 3233843..3234226 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
P6H84_RS15655 (3234439) | 3234439..3235764 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
P6H84_RS15660 (3235990) | 3235990..3236376 | + | 387 | WP_000539524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P6H84_RS15665 (3236366) | 3236366..3236695 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
P6H84_RS15670 (3236765) | 3236765..3238082 | - | 1318 | Protein_3076 | diguanylate cyclase | - |
P6H84_RS15675 (3238090) | 3238090..3240438 | - | 2349 | WP_000950331.1 | EAL domain-containing protein | - |
P6H84_RS15680 (3240615) | 3240615..3241526 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14321.46 Da Isoelectric Point: 9.9521
>T275937 WP_000539524.1 NZ_CP121153:3235990-3236376 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSRSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSRSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|