Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 855638..856470 | Replicon | chromosome |
| Accession | NZ_CP121153 | ||
| Organism | Escherichia coli strain E57 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | P6H84_RS04095 | Protein ID | WP_000854753.1 |
| Coordinates | 855638..856012 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | P6H84_RS04100 | Protein ID | WP_219412244.1 |
| Coordinates | 856102..856470 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H84_RS04065 (850750) | 850750..851898 | - | 1149 | WP_000905920.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| P6H84_RS04070 (851970) | 851970..852953 | - | 984 | WP_032152721.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| P6H84_RS04075 (853764) | 853764..853934 | - | 171 | Protein_801 | IS110 family transposase | - |
| P6H84_RS04080 (854276) | 854276..854847 | - | 572 | Protein_802 | DUF4942 domain-containing protein | - |
| P6H84_RS04085 (854944) | 854944..855141 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| P6H84_RS04090 (855153) | 855153..855641 | - | 489 | WP_000777545.1 | DUF5983 family protein | - |
| P6H84_RS04095 (855638) | 855638..856012 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| P6H84_RS04100 (856102) | 856102..856470 | - | 369 | WP_219412244.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| P6H84_RS04105 (856633) | 856633..856854 | - | 222 | WP_001405861.1 | DUF987 domain-containing protein | - |
| P6H84_RS04110 (856923) | 856923..857399 | - | 477 | WP_001186724.1 | RadC family protein | - |
| P6H84_RS04115 (857415) | 857415..857900 | - | 486 | WP_112917491.1 | antirestriction protein | - |
| P6H84_RS04120 (857955) | 857955..858773 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| P6H84_RS04125 (858873) | 858873..859106 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| P6H84_RS04130 (859185) | 859185..859640 | - | 456 | WP_072645706.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T275928 WP_000854753.1 NZ_CP121153:c856012-855638 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13680.51 Da Isoelectric Point: 6.8270
>AT275928 WP_219412244.1 NZ_CP121153:c856470-856102 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADHAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADHAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|