Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 4015841..4016678 | Replicon | chromosome |
| Accession | NZ_CP121151 | ||
| Organism | Escherichia coli strain E47 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | P6H31_RS20065 | Protein ID | WP_000227784.1 |
| Coordinates | 4016136..4016678 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | P6H31_RS20060 | Protein ID | WP_001297137.1 |
| Coordinates | 4015841..4016152 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H31_RS20035 (4010861) | 4010861..4011808 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
| P6H31_RS20040 (4011830) | 4011830..4013821 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| P6H31_RS20045 (4013811) | 4013811..4014425 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| P6H31_RS20050 (4014425) | 4014425..4014754 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| P6H31_RS20055 (4014766) | 4014766..4015656 | + | 891 | WP_000971336.1 | heme o synthase | - |
| P6H31_RS20060 (4015841) | 4015841..4016152 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| P6H31_RS20065 (4016136) | 4016136..4016678 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| P6H31_RS20070 (4016734) | 4016734..4017669 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
| P6H31_RS20075 (4018077) | 4018077..4019441 | + | 1365 | WP_001000978.1 | MFS transporter | - |
| P6H31_RS20080 (4019569) | 4019569..4020060 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| P6H31_RS20085 (4020228) | 4020228..4021139 | + | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T275914 WP_000227784.1 NZ_CP121151:4016136-4016678 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|