Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2829790..2830428 | Replicon | chromosome |
| Accession | NZ_CP121151 | ||
| Organism | Escherichia coli strain E47 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | P6H31_RS14165 | Protein ID | WP_000813794.1 |
| Coordinates | 2830252..2830428 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | P6H31_RS14160 | Protein ID | WP_001270286.1 |
| Coordinates | 2829790..2830206 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H31_RS14140 (2824942) | 2824942..2825883 | - | 942 | WP_001251319.1 | ABC transporter permease | - |
| P6H31_RS14145 (2825884) | 2825884..2826897 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| P6H31_RS14150 (2826915) | 2826915..2828060 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| P6H31_RS14155 (2828305) | 2828305..2829711 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| P6H31_RS14160 (2829790) | 2829790..2830206 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| P6H31_RS14165 (2830252) | 2830252..2830428 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| P6H31_RS14170 (2830650) | 2830650..2830880 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| P6H31_RS14175 (2830972) | 2830972..2832933 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| P6H31_RS14180 (2833006) | 2833006..2833542 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
| P6H31_RS14185 (2833595) | 2833595..2834809 | + | 1215 | WP_001349372.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2834849..2836114 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T275910 WP_000813794.1 NZ_CP121151:c2830428-2830252 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT275910 WP_001270286.1 NZ_CP121151:c2830206-2829790 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|