Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1372298..1372923 | Replicon | chromosome |
| Accession | NZ_CP121151 | ||
| Organism | Escherichia coli strain E47 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P6H31_RS06855 | Protein ID | WP_000911330.1 |
| Coordinates | 1372525..1372923 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | P6H31_RS06850 | Protein ID | WP_000450524.1 |
| Coordinates | 1372298..1372525 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H31_RS06825 (1368101) | 1368101..1368571 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| P6H31_RS06830 (1368571) | 1368571..1369143 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| P6H31_RS06835 (1369289) | 1369289..1370167 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| P6H31_RS06840 (1370184) | 1370184..1371218 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| P6H31_RS06845 (1371431) | 1371431..1372144 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| P6H31_RS06850 (1372298) | 1372298..1372525 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| P6H31_RS06855 (1372525) | 1372525..1372923 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P6H31_RS06860 (1373070) | 1373070..1373933 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
| P6H31_RS06865 (1373948) | 1373948..1375963 | + | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| P6H31_RS06870 (1376037) | 1376037..1376735 | + | 699 | WP_000679823.1 | esterase | - |
| P6H31_RS06875 (1376845) | 1376845..1377045 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T275902 WP_000911330.1 NZ_CP121151:1372525-1372923 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|