Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 284708..285493 | Replicon | chromosome |
| Accession | NZ_CP121151 | ||
| Organism | Escherichia coli strain E47 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | P6H31_RS01305 | Protein ID | WP_124062200.1 |
| Coordinates | 284981..285493 (+) | Length | 171 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | P6H31_RS01300 | Protein ID | WP_001277108.1 |
| Coordinates | 284708..284974 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H31_RS01280 (280366) | 280366..281034 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
| P6H31_RS01285 (281027) | 281027..282085 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
| P6H31_RS01290 (282330) | 282330..283184 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| P6H31_RS01295 (283455) | 283455..284558 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| P6H31_RS01300 (284708) | 284708..284974 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| P6H31_RS01305 (284981) | 284981..285493 | + | 513 | WP_124062200.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| P6H31_RS01310 (285490) | 285490..285873 | - | 384 | WP_000778795.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| P6H31_RS01315 (286297) | 286297..287406 | + | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| P6H31_RS01320 (287454) | 287454..288380 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| P6H31_RS01325 (288377) | 288377..289654 | + | 1278 | WP_000803771.1 | branched chain amino acid ABC transporter permease LivM | - |
| P6H31_RS01330 (289651) | 289651..290418 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 171 a.a. Molecular weight: 19061.90 Da Isoelectric Point: 6.9487
>T275898 WP_124062200.1 NZ_CP121151:284981-285493 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENALFFPTK
SIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENALFFPTK
SIELLFTQSD
Download Length: 513 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|