Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4332359..4332954 | Replicon | chromosome |
Accession | NZ_CP121149 | ||
Organism | Escherichia coli strain E14 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | P1I99_RS21030 | Protein ID | WP_000239579.1 |
Coordinates | 4332359..4332709 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | P1I99_RS21035 | Protein ID | WP_001223208.1 |
Coordinates | 4332703..4332954 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1I99_RS21010 (4327635) | 4327635..4328657 | - | 1023 | WP_001296689.1 | ABC transporter permease | - |
P1I99_RS21015 (4328671) | 4328671..4330173 | - | 1503 | WP_000205794.1 | sugar ABC transporter ATP-binding protein | - |
P1I99_RS21020 (4330483) | 4330483..4331439 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
P1I99_RS21025 (4331749) | 4331749..4332279 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
P1I99_RS21030 (4332359) | 4332359..4332709 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
P1I99_RS21035 (4332703) | 4332703..4332954 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
P1I99_RS21040 (4333166) | 4333166..4333507 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
P1I99_RS21045 (4333510) | 4333510..4337271 | - | 3762 | WP_276170941.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T275893 WP_000239579.1 NZ_CP121149:c4332709-4332359 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |