Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3624229..3624847 | Replicon | chromosome |
Accession | NZ_CP121149 | ||
Organism | Escherichia coli strain E14 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | P1I99_RS17690 | Protein ID | WP_001291435.1 |
Coordinates | 3624629..3624847 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | P1I99_RS17685 | Protein ID | WP_000344800.1 |
Coordinates | 3624229..3624603 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1I99_RS17675 (3619318) | 3619318..3620511 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P1I99_RS17680 (3620534) | 3620534..3623683 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
P1I99_RS17685 (3624229) | 3624229..3624603 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
P1I99_RS17690 (3624629) | 3624629..3624847 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
P1I99_RS17695 (3625018) | 3625018..3625569 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
P1I99_RS17700 (3625685) | 3625685..3626155 | + | 471 | WP_000136192.1 | YlaC family protein | - |
P1I99_RS17705 (3626319) | 3626319..3627869 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
P1I99_RS17710 (3627911) | 3627911..3628264 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
P1I99_RS17720 (3628643) | 3628643..3628954 | + | 312 | WP_000409911.1 | MGMT family protein | - |
P1I99_RS17725 (3628985) | 3628985..3629557 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T275890 WP_001291435.1 NZ_CP121149:3624629-3624847 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT275890 WP_000344800.1 NZ_CP121149:3624229-3624603 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |