Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 780626..781424 | Replicon | chromosome |
Accession | NZ_CP121149 | ||
Organism | Escherichia coli strain E14 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | U9XMP3 |
Locus tag | P1I99_RS03770 | Protein ID | WP_000854735.1 |
Coordinates | 780626..781003 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A067H947 |
Locus tag | P1I99_RS03775 | Protein ID | WP_001285415.1 |
Coordinates | 781050..781424 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1I99_RS03740 (776772) | 776772..777905 | + | 1134 | Protein_733 | Accessory colonization factor AcfD | - |
P1I99_RS03745 (778323) | 778323..778649 | - | 327 | WP_000779483.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
P1I99_RS03750 (778646) | 778646..778909 | - | 264 | WP_001143297.1 | type II toxin-antitoxin system ParD family antitoxin | - |
P1I99_RS03755 (778981) | 778981..779847 | - | 867 | WP_001280433.1 | DUF4942 domain-containing protein | - |
P1I99_RS03760 (779932) | 779932..780129 | - | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
P1I99_RS03765 (780141) | 780141..780629 | - | 489 | WP_000761677.1 | DUF5983 family protein | - |
P1I99_RS03770 (780626) | 780626..781003 | - | 378 | WP_000854735.1 | TA system toxin CbtA family protein | Toxin |
P1I99_RS03775 (781050) | 781050..781424 | - | 375 | WP_001285415.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
P1I99_RS03780 (781504) | 781504..781725 | - | 222 | WP_000692309.1 | DUF987 domain-containing protein | - |
P1I99_RS03785 (781788) | 781788..782264 | - | 477 | WP_001366855.1 | RadC family protein | - |
P1I99_RS03790 (782280) | 782280..782759 | - | 480 | WP_000844100.1 | antirestriction protein | - |
P1I99_RS03795 (782841) | 782841..783659 | - | 819 | WP_276170499.1 | DUF932 domain-containing protein | - |
P1I99_RS03800 (783749) | 783749..783982 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
P1I99_RS03805 (783988) | 783988..784665 | - | 678 | WP_001097302.1 | hypothetical protein | - |
P1I99_RS03810 (784813) | 784813..785493 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 778323..841879 | 63556 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14061.07 Da Isoelectric Point: 8.2904
>T275879 WP_000854735.1 NZ_CP121149:c781003-780626 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13663.32 Da Isoelectric Point: 5.8640
>AT275879 WP_001285415.1 NZ_CP121149:c781424-781050 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9XMP3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A067H947 |