Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 69017..69660 | Replicon | plasmid pE20-1 |
Accession | NZ_CP121148 | ||
Organism | Escherichia coli strain E20 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | P6H07_RS24175 | Protein ID | WP_001044768.1 |
Coordinates | 69244..69660 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | P6H07_RS24170 | Protein ID | WP_001261287.1 |
Coordinates | 69017..69247 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H07_RS24150 (64177) | 64177..65265 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
P6H07_RS24155 (65267) | 65267..67492 | + | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
P6H07_RS24160 (67542) | 67542..68441 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
P6H07_RS24165 (68431) | 68431..68721 | - | 291 | WP_000111771.1 | hypothetical protein | - |
P6H07_RS24170 (69017) | 69017..69247 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
P6H07_RS24175 (69244) | 69244..69660 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P6H07_RS24180 (69822) | 69822..71960 | - | 2139 | WP_000350638.1 | AAA family ATPase | - |
P6H07_RS24185 (72314) | 72314..72571 | + | 258 | WP_000343085.1 | hypothetical protein | - |
P6H07_RS24190 (72571) | 72571..73161 | + | 591 | WP_000194575.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mph(A) / tet(A) / aph(3')-Ia / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / blaCTX-M-27 / dfrA14 | - | 1..124410 | 124410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T275876 WP_001044768.1 NZ_CP121148:69244-69660 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |