Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4285994..4286589 | Replicon | chromosome |
Accession | NZ_CP121147 | ||
Organism | Escherichia coli strain E20 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | P6H07_RS20740 | Protein ID | WP_000239581.1 |
Coordinates | 4285994..4286344 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | P6H07_RS20745 | Protein ID | WP_001223213.1 |
Coordinates | 4286338..4286589 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H07_RS20720 (4281448) | 4281448..4282470 | - | 1023 | WP_001361374.1 | ABC transporter permease | - |
P6H07_RS20725 (4282484) | 4282484..4283986 | - | 1503 | WP_001095661.1 | ATP-binding cassette domain-containing protein | - |
P6H07_RS20730 (4284119) | 4284119..4285075 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
P6H07_RS20735 (4285385) | 4285385..4285915 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
P6H07_RS20740 (4285994) | 4285994..4286344 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
P6H07_RS20745 (4286338) | 4286338..4286589 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
P6H07_RS20750 (4286801) | 4286801..4287142 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
P6H07_RS20755 (4287145) | 4287145..4290924 | - | 3780 | WP_000060873.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T275870 WP_000239581.1 NZ_CP121147:c4286344-4285994 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|