Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 3678309..3679146 | Replicon | chromosome |
| Accession | NZ_CP121147 | ||
| Organism | Escherichia coli strain E20 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | A0A1M0D5U3 |
| Locus tag | P6H07_RS17815 | Protein ID | WP_000227782.1 |
| Coordinates | 3678604..3679146 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | B1LJI1 |
| Locus tag | P6H07_RS17810 | Protein ID | WP_001353405.1 |
| Coordinates | 3678309..3678620 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H07_RS17785 (3673329) | 3673329..3674276 | + | 948 | WP_001239437.1 | cytochrome o ubiquinol oxidase subunit II | - |
| P6H07_RS17790 (3674298) | 3674298..3676289 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| P6H07_RS17795 (3676279) | 3676279..3676893 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| P6H07_RS17800 (3676893) | 3676893..3677222 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| P6H07_RS17805 (3677234) | 3677234..3678124 | + | 891 | WP_000971327.1 | heme o synthase | - |
| P6H07_RS17810 (3678309) | 3678309..3678620 | + | 312 | WP_001353405.1 | DUF1778 domain-containing protein | Antitoxin |
| P6H07_RS17815 (3678604) | 3678604..3679146 | + | 543 | WP_000227782.1 | GNAT family N-acetyltransferase | Toxin |
| P6H07_RS17820 (3679202) | 3679202..3680046 | - | 845 | Protein_3491 | tetratricopeptide repeat protein | - |
| P6H07_RS17825 (3680453) | 3680453..3681817 | + | 1365 | WP_001000978.1 | MFS transporter | - |
| P6H07_RS17830 (3681945) | 3681945..3682436 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| P6H07_RS17835 (3682604) | 3682604..3683515 | + | 912 | WP_000705841.1 | 2-dehydropantoate 2-reductase | - |
| P6H07_RS17840 (3683478) | 3683478..3684068 | + | 591 | WP_001276320.1 | protein deglycase YajL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19957.31 Da Isoelectric Point: 9.1763
>T275867 WP_000227782.1 NZ_CP121147:3678604-3679146 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDIIYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCNFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDIIYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCNFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M0D5U3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G7G3 |