Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2034262..2035046 | Replicon | chromosome |
Accession | NZ_CP121147 | ||
Organism | Escherichia coli strain E20 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | P6H07_RS09715 | Protein ID | WP_000613626.1 |
Coordinates | 2034262..2034756 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | P6H07_RS09720 | Protein ID | WP_001110447.1 |
Coordinates | 2034753..2035046 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H07_RS09695 (2029455) | 2029455..2030552 | + | 1098 | WP_000589326.1 | flagellar basal body P-ring protein FlgI | - |
P6H07_RS09700 (2030552) | 2030552..2031493 | + | 942 | WP_001305885.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
P6H07_RS09705 (2031559) | 2031559..2033202 | + | 1644 | WP_061092652.1 | flagellar hook-associated protein FlgK | - |
P6H07_RS09710 (2033214) | 2033214..2034167 | + | 954 | WP_001212762.1 | flagellar hook-associated protein FlgL | - |
P6H07_RS09715 (2034262) | 2034262..2034756 | - | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
P6H07_RS09720 (2034753) | 2034753..2035046 | - | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
P6H07_RS09725 (2035179) | 2035179..2038364 | - | 3186 | WP_061092653.1 | ribonuclease E | - |
P6H07_RS09730 (2038937) | 2038937..2039896 | + | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T275858 WP_000613626.1 NZ_CP121147:c2034756-2034262 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|