Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1004904..1005558 | Replicon | chromosome |
| Accession | NZ_CP121147 | ||
| Organism | Escherichia coli strain E20 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4T2L4 |
| Locus tag | P6H07_RS04875 | Protein ID | WP_000244765.1 |
| Coordinates | 1005151..1005558 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | P6H07_RS04870 | Protein ID | WP_000354046.1 |
| Coordinates | 1004904..1005170 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H07_RS04850 (1000992) | 1000992..1002425 | - | 1434 | WP_063082439.1 | 6-phospho-beta-glucosidase BglA | - |
| P6H07_RS04855 (1002470) | 1002470..1002781 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| P6H07_RS04860 (1002945) | 1002945..1003604 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| P6H07_RS04865 (1003681) | 1003681..1004661 | - | 981 | WP_049038218.1 | tRNA-modifying protein YgfZ | - |
| P6H07_RS04870 (1004904) | 1004904..1005170 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| P6H07_RS04875 (1005151) | 1005151..1005558 | + | 408 | WP_000244765.1 | protein YgfX | Toxin |
| P6H07_RS04880 (1005598) | 1005598..1006119 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| P6H07_RS04885 (1006231) | 1006231..1007127 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| P6H07_RS04890 (1007152) | 1007152..1007862 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| P6H07_RS04895 (1007868) | 1007868..1009601 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T275856 WP_000244765.1 NZ_CP121147:1005151-1005558 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454A7D7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |