Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 878549..879381 | Replicon | chromosome |
| Accession | NZ_CP121147 | ||
| Organism | Escherichia coli strain E20 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | P6H07_RS04195 | Protein ID | WP_000854753.1 |
| Coordinates | 878549..878923 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | P6H07_RS04200 | Protein ID | WP_219412244.1 |
| Coordinates | 879013..879381 (-) | Length | 123 a.a. |
Genomic Context
Location: 873812..874168 (357 bp)
Type: Others
Protein ID: WP_032165636.1
Type: Others
Protein ID: WP_032165636.1
Location: 874223..875407 (1185 bp)
Type: Others
Protein ID: WP_023892874.1
Type: Others
Protein ID: WP_023892874.1
Location: 875753..876286 (534 bp)
Type: Others
Protein ID: WP_077252454.1
Type: Others
Protein ID: WP_077252454.1
Location: 877187..877758 (572 bp)
Type: Others
Protein ID: Protein_822
Type: Others
Protein ID: Protein_822
Location: 877855..878052 (198 bp)
Type: Others
Protein ID: WP_000839281.1
Type: Others
Protein ID: WP_000839281.1
Location: 878064..878552 (489 bp)
Type: Others
Protein ID: WP_000777545.1
Type: Others
Protein ID: WP_000777545.1
Location: 878549..878923 (375 bp)
Type: Toxin
Protein ID: WP_000854753.1
Type: Toxin
Protein ID: WP_000854753.1
Location: 879013..879381 (369 bp)
Type: Antitoxin
Protein ID: WP_219412244.1
Type: Antitoxin
Protein ID: WP_219412244.1
Location: 879544..879765 (222 bp)
Type: Others
Protein ID: WP_001405861.1
Type: Others
Protein ID: WP_001405861.1
Location: 879834..880310 (477 bp)
Type: Others
Protein ID: WP_001186724.1
Type: Others
Protein ID: WP_001186724.1
Location: 880326..880811 (486 bp)
Type: Others
Protein ID: WP_112917491.1
Type: Others
Protein ID: WP_112917491.1
Location: 880866..881684 (819 bp)
Type: Others
Protein ID: WP_001234620.1
Type: Others
Protein ID: WP_001234620.1
Location: 881784..882017 (234 bp)
Type: Others
Protein ID: WP_001119729.1
Type: Others
Protein ID: WP_001119729.1
Location: 882096..882551 (456 bp)
Type: Others
Protein ID: WP_072645706.1
Type: Others
Protein ID: WP_072645706.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H07_RS04165 (873812) | 873812..874168 | + | 357 | WP_032165636.1 | Arm DNA-binding domain-containing protein | - |
| P6H07_RS04170 (874223) | 874223..875407 | - | 1185 | WP_023892874.1 | site-specific integrase | - |
| P6H07_RS04175 (875753) | 875753..876286 | - | 534 | WP_077252454.1 | hypothetical protein | - |
| P6H07_RS04180 (877187) | 877187..877758 | - | 572 | Protein_822 | DUF4942 domain-containing protein | - |
| P6H07_RS04185 (877855) | 877855..878052 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| P6H07_RS04190 (878064) | 878064..878552 | - | 489 | WP_000777545.1 | DUF5983 family protein | - |
| P6H07_RS04195 (878549) | 878549..878923 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| P6H07_RS04200 (879013) | 879013..879381 | - | 369 | WP_219412244.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| P6H07_RS04205 (879544) | 879544..879765 | - | 222 | WP_001405861.1 | DUF987 domain-containing protein | - |
| P6H07_RS04210 (879834) | 879834..880310 | - | 477 | WP_001186724.1 | RadC family protein | - |
| P6H07_RS04215 (880326) | 880326..880811 | - | 486 | WP_112917491.1 | antirestriction protein | - |
| P6H07_RS04220 (880866) | 880866..881684 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| P6H07_RS04225 (881784) | 881784..882017 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| P6H07_RS04230 (882096) | 882096..882551 | - | 456 | WP_072645706.1 | IrmA family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T275855 WP_000854753.1 NZ_CP121147:c878923-878549 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13680.51 Da Isoelectric Point: 6.8270
>AT275855 WP_219412244.1 NZ_CP121147:c879381-879013 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADHAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADHAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| No matching records found | ||