Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4523194..4523851 | Replicon | chromosome |
Accession | NZ_CP121145 | ||
Organism | Klebsiella pneumoniae strain UHD-56_PH |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | P8T43_RS21830 | Protein ID | WP_002916310.1 |
Coordinates | 4523194..4523604 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | P8T43_RS21835 | Protein ID | WP_002916312.1 |
Coordinates | 4523585..4523851 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T43_RS21810 (P8T43_21805) | 4519194..4520927 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
P8T43_RS21815 (P8T43_21810) | 4520933..4521646 | - | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P8T43_RS21820 (P8T43_21815) | 4521669..4522565 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
P8T43_RS21825 (P8T43_21820) | 4522666..4523187 | + | 522 | WP_004144730.1 | flavodoxin FldB | - |
P8T43_RS21830 (P8T43_21825) | 4523194..4523604 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
P8T43_RS21835 (P8T43_21830) | 4523585..4523851 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
P8T43_RS21840 (P8T43_21835) | 4524097..4525080 | + | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
P8T43_RS21845 (P8T43_21840) | 4525231..4525890 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
P8T43_RS21850 (P8T43_21845) | 4526054..4526365 | - | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
P8T43_RS21855 (P8T43_21850) | 4526415..4527143 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
P8T43_RS21860 (P8T43_21855) | 4527262..4528695 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T275847 WP_002916310.1 NZ_CP121145:c4523604-4523194 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |