Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1289562..1290181 Replicon chromosome
Accession NZ_CP121145
Organism Klebsiella pneumoniae strain UHD-56_PH

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag P8T43_RS06110 Protein ID WP_002892050.1
Coordinates 1289562..1289780 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag P8T43_RS06115 Protein ID WP_002892066.1
Coordinates 1289807..1290181 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T43_RS06075 (P8T43_06075) 1285609..1285872 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
P8T43_RS06080 (P8T43_06080) 1285872..1286012 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
P8T43_RS06085 (P8T43_06085) 1286009..1286707 - 699 WP_032414604.1 GNAT family protein -
P8T43_RS06090 (P8T43_06090) 1286808..1288259 + 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
P8T43_RS06095 (P8T43_06095) 1288234..1288704 - 471 WP_002892026.1 YlaC family protein -
P8T43_RS06100 (P8T43_06100) 1288725..1288865 + 141 WP_004147370.1 hypothetical protein -
P8T43_RS06105 (P8T43_06105) 1288837..1289403 - 567 WP_002892030.1 maltose O-acetyltransferase -
P8T43_RS06110 (P8T43_06110) 1289562..1289780 - 219 WP_002892050.1 HHA domain-containing protein Toxin
P8T43_RS06115 (P8T43_06115) 1289807..1290181 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
P8T43_RS06120 (P8T43_06120) 1290667..1293813 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
P8T43_RS06125 (P8T43_06125) 1293836..1295029 - 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T275841 WP_002892050.1 NZ_CP121145:c1289780-1289562 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT275841 WP_002892066.1 NZ_CP121145:c1290181-1289807 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References