Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 81337..81962 | Replicon | chromosome |
| Accession | NZ_CP121145 | ||
| Organism | Klebsiella pneumoniae strain UHD-56_PH | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A378FVD4 |
| Locus tag | P8T43_RS00385 | Protein ID | WP_019705794.1 |
| Coordinates | 81579..81962 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | P8T43_RS00380 | Protein ID | WP_004150355.1 |
| Coordinates | 81337..81579 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T43_RS00355 (P8T43_00355) | 77328..77927 | + | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
| P8T43_RS00360 (P8T43_00360) | 77921..78781 | + | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| P8T43_RS00365 (P8T43_00365) | 78778..79215 | + | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| P8T43_RS00370 (P8T43_00370) | 79260..80201 | + | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
| P8T43_RS00375 (P8T43_00375) | 80215..81132 | - | 918 | WP_012737090.1 | alpha/beta hydrolase | - |
| P8T43_RS00380 (P8T43_00380) | 81337..81579 | + | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| P8T43_RS00385 (P8T43_00385) | 81579..81962 | + | 384 | WP_019705794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P8T43_RS00390 (P8T43_00390) | 82136..83065 | - | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| P8T43_RS00395 (P8T43_00395) | 83062..83697 | - | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P8T43_RS00400 (P8T43_00400) | 83694..84596 | - | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14358.57 Da Isoelectric Point: 6.8806
>T275837 WP_019705794.1 NZ_CP121145:81579-81962 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378FVD4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |