Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 146189..146925 Replicon plasmid pESBL-PH-57
Accession NZ_CP121144
Organism Klebsiella pneumoniae strain UHD-57_PH

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag P8T33_RS26575 Protein ID WP_003026803.1
Coordinates 146443..146925 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag P8T33_RS26570 Protein ID WP_003026799.1
Coordinates 146189..146455 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T33_RS26525 (P8T33_26520) 142251..142613 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
P8T33_RS26530 (P8T33_26525) 142663..143013 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
P8T33_RS26535 (P8T33_26530) 143371..143640 + 270 WP_004152102.1 hypothetical protein -
P8T33_RS26540 (P8T33_26535) 143628..144203 + 576 WP_004152103.1 hypothetical protein -
P8T33_RS26545 (P8T33_26540) 144234..144728 + 495 WP_004152104.1 DNA-binding protein -
P8T33_RS26550 (P8T33_26545) 144772..145140 + 369 WP_004152105.1 hypothetical protein -
P8T33_RS26555 (P8T33_26550) 145174..145377 + 204 WP_004152106.1 HHA domain-containing protein -
P8T33_RS26560 (P8T33_26555) 145426..145683 + 258 WP_004152107.1 hypothetical protein -
P8T33_RS26565 (P8T33_26560) 145759..146013 + 255 WP_004152108.1 hypothetical protein -
P8T33_RS26570 (P8T33_26565) 146189..146455 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
P8T33_RS26575 (P8T33_26570) 146443..146925 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
P8T33_RS26580 (P8T33_26575) 147133..148479 + 1347 WP_077253535.1 ISNCY family transposase -
P8T33_RS26585 (P8T33_26580) 148528..148923 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
P8T33_RS26590 (P8T33_26585) 149071..150236 - 1166 Protein_162 IS3 family transposase -
P8T33_RS26595 (P8T33_26590) 150413..151375 - 963 WP_004152113.1 zinc metalloprotease HtpX -
P8T33_RS26600 (P8T33_26595) 151362..151850 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qnrB1 / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr - 1..247179 247179


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T275836 WP_003026803.1 NZ_CP121144:146443-146925 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT275836 WP_003026799.1 NZ_CP121144:146189-146455 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References