Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 146189..146925 | Replicon | plasmid pESBL-PH-57 |
| Accession | NZ_CP121144 | ||
| Organism | Klebsiella pneumoniae strain UHD-57_PH | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | P8T33_RS26575 | Protein ID | WP_003026803.1 |
| Coordinates | 146443..146925 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | P8T33_RS26570 | Protein ID | WP_003026799.1 |
| Coordinates | 146189..146455 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T33_RS26525 (P8T33_26520) | 142251..142613 | - | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
| P8T33_RS26530 (P8T33_26525) | 142663..143013 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| P8T33_RS26535 (P8T33_26530) | 143371..143640 | + | 270 | WP_004152102.1 | hypothetical protein | - |
| P8T33_RS26540 (P8T33_26535) | 143628..144203 | + | 576 | WP_004152103.1 | hypothetical protein | - |
| P8T33_RS26545 (P8T33_26540) | 144234..144728 | + | 495 | WP_004152104.1 | DNA-binding protein | - |
| P8T33_RS26550 (P8T33_26545) | 144772..145140 | + | 369 | WP_004152105.1 | hypothetical protein | - |
| P8T33_RS26555 (P8T33_26550) | 145174..145377 | + | 204 | WP_004152106.1 | HHA domain-containing protein | - |
| P8T33_RS26560 (P8T33_26555) | 145426..145683 | + | 258 | WP_004152107.1 | hypothetical protein | - |
| P8T33_RS26565 (P8T33_26560) | 145759..146013 | + | 255 | WP_004152108.1 | hypothetical protein | - |
| P8T33_RS26570 (P8T33_26565) | 146189..146455 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| P8T33_RS26575 (P8T33_26570) | 146443..146925 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| P8T33_RS26580 (P8T33_26575) | 147133..148479 | + | 1347 | WP_077253535.1 | ISNCY family transposase | - |
| P8T33_RS26585 (P8T33_26580) | 148528..148923 | + | 396 | WP_004143398.1 | helix-turn-helix domain-containing protein | - |
| P8T33_RS26590 (P8T33_26585) | 149071..150236 | - | 1166 | Protein_162 | IS3 family transposase | - |
| P8T33_RS26595 (P8T33_26590) | 150413..151375 | - | 963 | WP_004152113.1 | zinc metalloprotease HtpX | - |
| P8T33_RS26600 (P8T33_26595) | 151362..151850 | - | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qnrB1 / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr | - | 1..247179 | 247179 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T275836 WP_003026803.1 NZ_CP121144:146443-146925 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |