Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4302807..4303546 | Replicon | chromosome |
| Accession | NZ_CP121143 | ||
| Organism | Klebsiella pneumoniae strain UHD-57_PH | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | P8T33_RS20735 | Protein ID | WP_032415800.1 |
| Coordinates | 4303061..4303546 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | P8T33_RS20730 | Protein ID | WP_003026799.1 |
| Coordinates | 4302807..4303073 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T33_RS20715 (P8T33_20710) | 4298310..4300379 | + | 2070 | WP_002922127.1 | glycine--tRNA ligase subunit beta | - |
| P8T33_RS20720 (P8T33_20715) | 4300676..4302045 | + | 1370 | WP_087830479.1 | IS3 family transposase | - |
| P8T33_RS20725 (P8T33_20720) | 4302246..4302674 | + | 429 | WP_004901287.1 | GFA family protein | - |
| P8T33_RS20730 (P8T33_20725) | 4302807..4303073 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| P8T33_RS20735 (P8T33_20730) | 4303061..4303546 | + | 486 | WP_032415800.1 | GNAT family N-acetyltransferase | Toxin |
| P8T33_RS20740 (P8T33_20735) | 4303890..4304042 | + | 153 | WP_002922102.1 | type I toxin-antitoxin system toxin HokA | - |
| P8T33_RS20745 (P8T33_20740) | 4304344..4305963 | + | 1620 | WP_032415799.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| P8T33_RS20750 (P8T33_20745) | 4306062..4306274 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| P8T33_RS20755 (P8T33_20750) | 4306527..4306817 | - | 291 | WP_002921931.1 | HTH-type transcriptional regulator | - |
| P8T33_RS20760 (P8T33_20755) | 4307063..4308418 | - | 1356 | WP_032415797.1 | aromatic acid/H+ symport family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4301320..4302045 | 725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17624.46 Da Isoelectric Point: 10.1428
>T275832 WP_032415800.1 NZ_CP121143:4303061-4303546 [Klebsiella pneumoniae]
VGRITAPEPLCSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLCSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|