Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4025035..4025660 | Replicon | chromosome |
Accession | NZ_CP121143 | ||
Organism | Klebsiella pneumoniae strain UHD-57_PH |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A378FVD4 |
Locus tag | P8T33_RS19395 | Protein ID | WP_019705794.1 |
Coordinates | 4025035..4025418 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | P8T33_RS19400 | Protein ID | WP_004150355.1 |
Coordinates | 4025418..4025660 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T33_RS19380 (P8T33_19375) | 4022401..4023303 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
P8T33_RS19385 (P8T33_19380) | 4023300..4023935 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
P8T33_RS19390 (P8T33_19385) | 4023932..4024861 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
P8T33_RS19395 (P8T33_19390) | 4025035..4025418 | - | 384 | WP_019705794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P8T33_RS19400 (P8T33_19395) | 4025418..4025660 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
P8T33_RS19405 (P8T33_19400) | 4025865..4026782 | + | 918 | WP_012737090.1 | alpha/beta hydrolase | - |
P8T33_RS19410 (P8T33_19405) | 4026796..4027737 | - | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
P8T33_RS19415 (P8T33_19410) | 4027782..4028219 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
P8T33_RS19420 (P8T33_19415) | 4028216..4029076 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
P8T33_RS19425 (P8T33_19420) | 4029070..4029669 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14358.57 Da Isoelectric Point: 6.8806
>T275831 WP_019705794.1 NZ_CP121143:c4025418-4025035 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A378FVD4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |