Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3543168..3543684 | Replicon | chromosome |
| Accession | NZ_CP121143 | ||
| Organism | Klebsiella pneumoniae strain UHD-57_PH | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | P8T33_RS17085 | Protein ID | WP_004178374.1 |
| Coordinates | 3543168..3543452 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | P8T33_RS17090 | Protein ID | WP_002886901.1 |
| Coordinates | 3543442..3543684 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T33_RS17060 (P8T33_17055) | 3538564..3538872 | - | 309 | WP_002886907.1 | PTS sugar transporter subunit IIB | - |
| P8T33_RS17065 (P8T33_17060) | 3538957..3539130 | + | 174 | WP_004222159.1 | hypothetical protein | - |
| P8T33_RS17070 (P8T33_17065) | 3539133..3539876 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| P8T33_RS17075 (P8T33_17070) | 3540233..3542371 | + | 2139 | WP_032415880.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| P8T33_RS17080 (P8T33_17075) | 3542700..3543164 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| P8T33_RS17085 (P8T33_17080) | 3543168..3543452 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8T33_RS17090 (P8T33_17085) | 3543442..3543684 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| P8T33_RS17095 (P8T33_17090) | 3543762..3545672 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
| P8T33_RS17100 (P8T33_17095) | 3545695..3546849 | - | 1155 | WP_032415878.1 | lactonase family protein | - |
| P8T33_RS17105 (P8T33_17100) | 3546916..3547656 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T275829 WP_004178374.1 NZ_CP121143:c3543452-3543168 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |