Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2816816..2817435 Replicon chromosome
Accession NZ_CP121143
Organism Klebsiella pneumoniae strain UHD-57_PH

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag P8T33_RS13665 Protein ID WP_002892050.1
Coordinates 2817217..2817435 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag P8T33_RS13660 Protein ID WP_002892066.1
Coordinates 2816816..2817190 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T33_RS13650 (P8T33_13645) 2811968..2813161 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
P8T33_RS13655 (P8T33_13650) 2813184..2816330 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
P8T33_RS13660 (P8T33_13655) 2816816..2817190 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
P8T33_RS13665 (P8T33_13660) 2817217..2817435 + 219 WP_002892050.1 HHA domain-containing protein Toxin
P8T33_RS13670 (P8T33_13665) 2817594..2818160 + 567 WP_002892030.1 maltose O-acetyltransferase -
P8T33_RS13675 (P8T33_13670) 2818132..2818272 - 141 WP_004147370.1 hypothetical protein -
P8T33_RS13680 (P8T33_13675) 2818293..2818763 + 471 WP_002892026.1 YlaC family protein -
P8T33_RS13685 (P8T33_13680) 2818738..2820189 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
P8T33_RS13690 (P8T33_13685) 2820290..2820988 + 699 WP_032414604.1 GNAT family protein -
P8T33_RS13695 (P8T33_13690) 2820985..2821125 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
P8T33_RS13700 (P8T33_13695) 2821125..2821388 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T275827 WP_002892050.1 NZ_CP121143:2817217-2817435 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT275827 WP_002892066.1 NZ_CP121143:2816816-2817190 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References