Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 126757..127493 Replicon plasmid pESBL-PH-58
Accession NZ_CP121142
Organism Klebsiella pneumoniae strain UHD-58_PH

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag P8T47_RS26445 Protein ID WP_003026803.1
Coordinates 127011..127493 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag P8T47_RS26440 Protein ID WP_003026799.1
Coordinates 126757..127023 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T47_RS26395 (P8T47_26395) 122819..123181 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
P8T47_RS26400 (P8T47_26400) 123231..123581 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
P8T47_RS26405 (P8T47_26405) 123939..124208 + 270 WP_004152102.1 hypothetical protein -
P8T47_RS26410 (P8T47_26410) 124196..124771 + 576 WP_004152103.1 hypothetical protein -
P8T47_RS26415 (P8T47_26415) 124802..125296 + 495 WP_004152104.1 DNA-binding protein -
P8T47_RS26420 (P8T47_26420) 125340..125708 + 369 WP_004152105.1 hypothetical protein -
P8T47_RS26425 (P8T47_26425) 125742..125945 + 204 WP_004152106.1 HHA domain-containing protein -
P8T47_RS26430 (P8T47_26430) 125994..126251 + 258 WP_004152107.1 hypothetical protein -
P8T47_RS26435 (P8T47_26435) 126327..126581 + 255 WP_004152108.1 hypothetical protein -
P8T47_RS26440 (P8T47_26440) 126757..127023 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
P8T47_RS26445 (P8T47_26445) 127011..127493 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
P8T47_RS26450 (P8T47_26450) 127701..129047 + 1347 WP_077253535.1 ISNCY family transposase -
P8T47_RS26455 (P8T47_26455) 129096..129491 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
P8T47_RS26460 (P8T47_26460) 129639..130804 - 1166 Protein_139 IS3 family transposase -
P8T47_RS26465 (P8T47_26465) 130981..131943 - 963 WP_004152113.1 zinc metalloprotease HtpX -
P8T47_RS26470 (P8T47_26470) 131930..132418 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / tet(A) / qnrB1 / dfrA14 - 1..247179 247179


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T275821 WP_003026803.1 NZ_CP121142:127011-127493 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT275821 WP_003026799.1 NZ_CP121142:126757-127023 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References